PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P05170_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 393aa    MW: 42906.8 Da    PI: 5.9867
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P05170_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-073353682154
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            k +yp+++++++L +++gL+ +q+ +WF N+R +
  GSMUA_Achr7P05170_001 335 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 368
                            469*****************************87 PP

2ELK28.92.5e-10289310122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L+++Y+++++++++E++
  GSMUA_Achr7P05170_001 289 ELKHELKQGYKEKIVDIREEIL 310
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.3E-20121165IPR005540KNOX1
PfamPF037906.2E-18123164IPR005540KNOX1
SMARTSM012563.1E-28177232IPR005541KNOX2
PfamPF037912.7E-20181231IPR005541KNOX2
PfamPF037899.0E-7289310IPR005539ELK domain
PROSITE profilePS512139.969289309IPR005539ELK domain
SMARTSM011886.1E-4289310IPR005539ELK domain
PROSITE profilePS5007111.645309372IPR001356Homeobox domain
SuperFamilySSF466896.42E-16311376IPR009057Homeodomain-like
SMARTSM003893.0E-11311376IPR001356Homeobox domain
CDDcd000861.13E-11312373No hitNo description
Gene3DG3DSA:1.10.10.602.5E-25316373IPR009057Homeodomain-like
PfamPF059202.8E-17329368IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MAFHNHLSHE LTLPQYAEQQ LAATAGKPSM AGAGGPTWLN SAILRQQGHH YADGSFLHLQ  60
TSADSSASPV PVSSDSAMAA AISAEPGGGR GHSGGELGEA EALAQGSGGG GEAGEGTWQN  120
ARYKAEILAH PLYEQLLSAH VACLRIATPV DQLPRIDAQL AQSQQVVSKY SVLGGGGGQM  180
LGDDKELDQF MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WELEQSLQSL TGVSPGEGTG  240
ATMSDDDDDQ AESETNLFDG SLDGPDSMGF GPLVPTESER SLMERVRQEL KHELKQGYKE  300
KIVDIREEIL RKRRAGKLPG DSTSTLKAWW QSHSKWPYPT EDDKARLVQE TGLQLKQINN  360
WFINQRKRNW HSNPSSSSTM KSKRKRFAIN DYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13312376872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365385RKRNWHSNPSSSSTMKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408038.10.0PREDICTED: homeobox protein knotted-1-like 13
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0TEV70.0M0TEV7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05170_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-168KNOTTED1-like homeobox gene 3